PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02032.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 398aa    MW: 46456.3 Da    PI: 6.9652
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02032.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1806.3e-5671361129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeek.ewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPtdeelv++yL+kkv++k++e+ ++ik+vd+yk+ePwdL++  k+ +ee+ ewyfFs++dkky+tg+r+nratk+g+W
  Rsa1.0_02032.1_g00004.1   7 VPPGFRFHPTDEELVDYYLRKKVASKRIEI-DFIKDVDLYKIEPWDLQElcKIGNEEQsEWYFFSHKDKKYPTGTRTNRATKAGFW 91 
                              69****************************.99**************954555554445*************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              katg+dk+++  ++ l+g++ktLvfykgrap+g+k+dW+mheyrle
  Rsa1.0_02032.1_g00004.1  92 KATGRDKSIYL-RHGLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                              ***********.8889****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-605156IPR003441NAC domain
PROSITE profilePS5100559.0817156IPR003441NAC domain
PfamPF023651.3E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MDSFTRVPPG FRFHPTDEEL VDYYLRKKVA SKRIEIDFIK DVDLYKIEPW DLQELCKIGN  60
EEQSEWYFFS HKDKKYPTGT RTNRATKAGF WKATGRDKSI YLRHGLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLEINEN GAPQEEGWVV CRVFKKRLAA TMRRMEDYES SPSNWYDDHL  180
SFMASELHSN PPSRTLHNHH HHQQPFPYGL NASSACTHNN NPNLQCKKEL ELHYNHMVQH  240
QQQNHHLHES IFHQIPQLET PNSNCNSLPY GSSNNGNNTR NIGKLQQSST LTHQEQFQQG  300
SQSFRSVYYD QDDQVNTDWR VLDKFVASQL SNEEVAAPAS ASTHQNNNKM DARNTDYQMH  360
QGMNLLENDS ERVFDMGEEH ANAHAGFSSS SYQIDLWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-50715715169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013752502.10.0PREDICTED: NAC domain-containing protein 26-like
RefseqXP_013752501.10.0PREDICTED: NAC domain-containing protein 26-like
RefseqXP_009113057.10.0PREDICTED: NAC domain-containing protein 7
RefseqXP_009113056.10.0PREDICTED: NAC domain-containing protein 7
SwissprotF4HYV50.0NAC26_ARATH; NAC domain-containing protein 26
TrEMBLM4EE140.0M4EE14_BRARP; Uncharacterized protein
STRINGBra027024.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21112678
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62700.10.0Arabidopsis NAC domain containing protein 26